Dense Granule Protein 6, Recombinant, Toxoplasma gondii, aa35-150, GST-Tag

Artikelnummer: USB-584214
Artikelname: Dense Granule Protein 6, Recombinant, Toxoplasma gondii, aa35-150, GST-Tag
Artikelnummer: USB-584214
Hersteller Artikelnummer: 584214
Alternativnummer: USB-584214-20,USB-584214-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Major granular component involved in excreted-secreted antigen (ESA) immunity. May have a structural role in the membranous network of the parasitophorous vacuole (PV). Source: Recombinant protein corresponding to aa35-150 from Toxoplasma gondii Dense granule protein 6, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.6kD Amino Acid Sequence: NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.6
UniProt: Q27003
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.