Dihydrofolate Reductase, Recombinant, Staphylococcus Aureus, aa2-159, His-Tag, Myc-Tag

Artikelnummer: USB-584244
Artikelname: Dihydrofolate Reductase, Recombinant, Staphylococcus Aureus, aa2-159, His-Tag, Myc-Tag
Artikelnummer: USB-584244
Hersteller Artikelnummer: 584244
Alternativnummer: USB-584244-20,USB-584244-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. Source: Recombinant protein corresponding to aa2-159 from Staphylococcus aureus Dihydrofolate reductase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~25.6kD Amino Acid Sequence: TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.6
UniProt: P99079
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.