Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1). It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B. Source: Recombinant protein corresponding to aa1-67 from Echis carinatus Disintegrin EC3B fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.4kD Amino Acid Sequence: NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
