DNA Mismatch Repair Protein MutL, Recombinant, Thermus aquaticus, aa186-312, His-Tag, Myc-Tag

Artikelnummer: USB-584271
Artikelname: DNA Mismatch Repair Protein MutL, Recombinant, Thermus aquaticus, aa186-312, His-Tag, Myc-Tag
Artikelnummer: USB-584271
Hersteller Artikelnummer: 584271
Alternativnummer: USB-584271-20,USB-584271-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a molecular matchmaker, a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex. Source: Recombinant protein corresponding to aa186-312 from Thermus aquaticus DNA mismatch repair protein mutL, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~21.3kD Amino Acid Sequence: LFPGAGLKEAARQAFGGLLAERLFPLEKGGAFALEGLLTGPQVSRTRPDLLFLAVNGRPVALPEGVLRAVRRAYRELLPEGHYPVGVLNLSLPPGAYRLRLDARKEEVALSKEAEAFLEEALEEAFR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.3
UniProt: P96082
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.