Double Homeobox Protein 4, Recombinant, Human, aa327-424, His-Tag

Artikelnummer: USB-584301
Artikelname: Double Homeobox Protein 4, Recombinant, Human, aa327-424, His-Tag
Artikelnummer: USB-584301
Hersteller Artikelnummer: 584301
Alternativnummer: USB-584301-20,USB-584301-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcription factor that is selectively and transiently expressed in cleavage-stage embryos. Binds to double-stranded DNA elements with the consensus sequence 5-TAATCTAATCA-3. Binds to chromatin containing histone H3 acetylated at Lys-27 (H3K27ac) and promotes deacetylation of H3K27ac. In parallel, binds to chromatin that lacks histone H3 acetylation at Lys-27 (H3K27ac) and recruits EP300 and CREBBP to promote acetylation of histone H3 at Lys-27 at new sites. Involved in transcriptional regulation of numerous genes, primarily as transcriptional activator, but mediates also repression of a set of target genes. Promotes expression of ZSCAN4 and KDM4E, two proteins with essential roles during early embryogenesis. Heterologous expression in cultured embryonic stem cells mediates also transcription of HERVL retrotransposons and transcripts derived from ACRO1 and HSATII satellite repeats. May activate expression of PITX1. May regulate microRNA (miRNA) expression. Inappropriate expression can inhibit myogenesis and promote apoptosis., Probably inactive as a transcriptional activator, due to the absence of the C-terminal region that is important for transcriptional activation. Can inhibit transcriptional activation mediated by isoform 1. Heterologous expression of isoform 2 has no deleterious effect on cell survival. Source: Recombinant protein corresponding to aa327-424 from human Double homeobox protein 4, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~14.3kD Amino Acid Sequence: AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.3
UniProt: Q9UBX2
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.