Double-stranded DNA-binding Protein, Recombinant, Enterobacteria phage T4, aa1-89, His-Tag, Myc-Tag

Artikelnummer: USB-584303
Artikelname: Double-stranded DNA-binding Protein, Recombinant, Enterobacteria phage T4, aa1-89, His-Tag, Myc-Tag
Artikelnummer: USB-584303
Hersteller Artikelnummer: 584303
Alternativnummer: USB-584303-20,USB-584303-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions. Full length recombinant protein corresponding to aa1-89 from Enterobacteria phage T4 Double-stranded DNA-binding protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Swiss/Uniprot: P13320 Molecular Weight: ~17.8kD Amino Acid Sequence: MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.8
UniProt: P13320
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.