Early Growth Response Protein 1, Recombinant, Human, aa444-543, His-B2M-Tag

Artikelnummer: USB-584343
Artikelname: Early Growth Response Protein 1, Recombinant, Human, aa444-543, His-B2M-Tag
Artikelnummer: USB-584343
Hersteller Artikelnummer: 584343
Alternativnummer: USB-584343-20,USB-584343-100,USB-584343-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional regulator. Source: Recombinant protein corresponding to aa444-543 from human Early growth response protein 1, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.1kD Amino Acid Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.1
UniProt: P18146
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.