Endo-beta-N-acetylglucosaminidase H, Recombinant, Streptomyces plicatus, aa45-313, His-Tag

Artikelnummer: USB-584363
Artikelname: Endo-beta-N-acetylglucosaminidase H, Recombinant, Streptomyces plicatus, aa45-313, His-Tag
Artikelnummer: USB-584363
Hersteller Artikelnummer: 584363
Alternativnummer: USB-584363-20,USB-584363-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins. Source: Recombinant protein corresponding to aa45-313 from Streptomyces plicatus Endo-beta-N-acetylglucosaminidase H, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~31.2kD Amino Acid Sequence: APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.2
UniProt: P04067
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.