Envelope Glycoprotein B, Recombinant, Human herpesvirus 7, aa23-259, His-Tag
Artikelnummer:
USB-584403
Hersteller Artikelnummer:
584403
Alternativnummer:
USB-584403-20,USB-584403-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress. Source: Recombinant protein corresponding to aa23-259 from Human herpesvirus 7 Envelope glycoprotein B, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.4kD Amino Acid Sequence: DFVMTGHNQHLPFRICSIATGTDLVRFDREVSCASYGSNIKTTEGILIIYKTKIEAHTFSVRTFKKELTFQTTYRDVGTVYFLDRTVTTLPMPIEEVHMVNTEARCLSSISVKRSEEEEYVAYHKDEYVNKTLDLIPLNFKSDTVRRYITTKEPFLRNGPLWFYSTSTSINCIVTDCIAKTKYPFDFFALSTGETVEGSPFYNGINSKTFNEPTEKILFRNNYTMLKTFDDGSKGNF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.