Envelope Glycoprotein G, Recombinant, Human herpesvirus 1, aa25-189, His-SUMO-Tag

Produktübersicht

• Artikelname: Envelope Glycoprotein G, Recombinant, Human herpesvirus 1, aa25-189, His-SUMO-Tag
• Artikelnummer: USB-584406
• Hersteller Artikelnummer: 584406
• Alternativnummer: USB-584406-20,USB-584406-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Chemokine-binding protein that inhibits neutrophils chemotaxis. Source: Recombinant protein corresponding to aa25-189 from Human herpesvirus 1 Envelope glycoprotein G, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.4kD Amino Acid Sequence: VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.4
• UniProt: P06484
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.