Envelope Glycoprotein H, Recombinant, Human cytomegalovirus, aa24-195, His-SUMO-Tag

Artikelnummer: USB-584410
Artikelname: Envelope Glycoprotein H, Recombinant, Human cytomegalovirus, aa24-195, His-SUMO-Tag
Artikelnummer: USB-584410
Hersteller Artikelnummer: 584410
Alternativnummer: USB-584410-20,USB-584410-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis. In human cytomegalovirus, forms two distincts complexes to mediate viral entry, a trimer and a pentamer at the surface of the virion envelope. The gH-gL-gO trimer is required for infection in fibroblasts by interacting with host PDGFRA. The gH-gL-UL128-UL130-UL131A pentamer is essential for viral entry in epithelial, endothelial and myeloid cells via interaction with host NRP2. Source: Recombinant protein corresponding to aa24-195 from human cytomegalovirus Envelope glycoprotein H, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.8kD Amino Acid Sequence: RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.8
UniProt: P12824
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.