EspC Protein Homolog, Recombinant, Mycobacterium bovis, aa1-103, His-Tag

Artikelnummer: USB-584464
Artikelname: EspC Protein Homolog, Recombinant, Mycobacterium bovis, aa1-103, His-Tag
Artikelnummer: USB-584464
Hersteller Artikelnummer: 584464
Alternativnummer: USB-584464-20,USB-584464-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-103 from Mycobacterium bovis EspC protein homolog, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~16.3kD Amino Acid Sequence: MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.3
UniProt: P65088
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.