ESX-1 Secretion-associated Protein EspK, Recombinant, Mycobacterium Tuberculosis, aa21-114, His-Tag, Myc-Tag

Artikelnummer: USB-584467
Artikelname: ESX-1 Secretion-associated Protein EspK, Recombinant, Mycobacterium Tuberculosis, aa21-114, His-Tag, Myc-Tag
Artikelnummer: USB-584467
Hersteller Artikelnummer: 584467
Alternativnummer: USB-584467-20,USB-584467-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May act as a chaperone that facilitates EspB secretion through an interaction with EccCb1. Source: Recombinant protein corresponding to aa21-114 from Mycobacterium tuberculosis ESX-1 secretion-associated protein EspK, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~17.7kD Amino Acid Sequence: VEADEDTFYDRAQEYSQVLQRVTDVLDTCRQQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAGLIEQAKSDIGNNVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.7
UniProt: P9WJC1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.