Fatty Acid-binding Protein, Recombinant, Human, aa1-135, GST-Tag

Artikelnummer: USB-584507
Artikelname: Fatty Acid-binding Protein, Recombinant, Human, aa1-135, GST-Tag
Artikelnummer: USB-584507
Hersteller Artikelnummer: 584507
Alternativnummer: USB-584507-20,USB-584507-100
Hersteller: US Biological
Kategorie: Molekularbiologie
High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Source: Recombinant protein corresponding to aa1-135 from human Fatty acid-binding protein, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~42.2kD Amino Acid Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.2
UniProt: Q01469
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.