Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag

Produktübersicht

• Artikelname: Ferric Uptake Regulation Protein, Recombinant, E. coli, aa2-148, His-Tag
• Artikelnummer: USB-584518
• Hersteller Artikelnummer: 584518
• Alternativnummer: USB-584518-20,USB-584518-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Acts as a global negative controlling element, employing Fe(2+) as a cofactor to bind the operator of the repressed genes. Regulates the expression of several outer-membrane proteins including the iron transport operon. Source: Recombinant protein corresponding to aa2-148 from Escherichia coli Ferric uptake regulation protein, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.7kD Amino Acid Sequence: TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 18.7
• UniProt: P0A9A9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.