Fibroblast Growth Factor 2, Recombinant, Human, aa143-288, MBP-Tag, His-Avi-Tag (Biotin)

Artikelnummer: USB-584528
Artikelname: Fibroblast Growth Factor 2, Recombinant, Human, aa143-288, MBP-Tag, His-Avi-Tag (Biotin)
Artikelnummer: USB-584528
Hersteller Artikelnummer: 584528
Alternativnummer: USB-584528-20,USB-584528-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. Source: Recombinant protein corresponding to aa143-288 from human Fibroblast growth factor 2, fused to MBP-Tag at N-terminal and 6X His-Avi-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~64.2kD Amino Acid Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 64.2
UniProt: P09038
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.