Fibronectin Type III Domain-containing Protein 5, Recombinant, Human, aa32-143, His-SUMO-Tag
Artikelnummer:
USB-584543
Hersteller Artikelnummer:
584543
Alternativnummer:
USB-584543-20,USB-584543-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue. Source: Recombinant protein corresponding to aa32-143 from human Fibronectin type III domain-containing protein 5, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.6kD Amino Acid Sequence: DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten