Follicle-stimulating Hormone Receptor, Recombinant, Human, aa18-366, His-Tag

Artikelnummer: USB-584568
Artikelname: Follicle-stimulating Hormone Receptor, Recombinant, Human, aa18-366, His-Tag
Artikelnummer: USB-584568
Hersteller Artikelnummer: 584568
Alternativnummer: USB-584568-20,USB-584568-100
Hersteller: US Biological
Kategorie: Molekularbiologie
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways. Source: Recombinant protein corresponding to aa18-366 from human Follicle-stimulating hormone receptor, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~43.5kD Amino Acid Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 43.5
UniProt: P23945
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.