Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag

Artikelnummer: USB-584634
Artikelname: Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag
Artikelnummer: USB-584634
Hersteller Artikelnummer: 584634
Alternativnummer: USB-584634-20,USB-584634-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Recombinant protein corresponding to aa22-138 from human Gastric inhibitory polypeptide receptor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.5kD Amino Acid Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.5
UniProt: P48546
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.