Gellan Lyase, Recombinant, Geobacillus stearothermophilus, aa1-204, His-Tag

Artikelnummer: USB-584644
Artikelname: Gellan Lyase, Recombinant, Geobacillus stearothermophilus, aa1-204, His-Tag
Artikelnummer: USB-584644
Hersteller Artikelnummer: 584644
Alternativnummer: USB-584644-20,USB-584644-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan. Source: Recombinant protein corresponding to aa1-204 from Geobacillus stearothermophilus Gellan lyase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.5kD Amino Acid Sequence: LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.5
UniProt: P85513
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.