GFP-like Non-fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, hFC-Tag

Artikelnummer: USB-584663
Artikelname: GFP-like Non-fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, hFC-Tag
Artikelnummer: USB-584663
Hersteller Artikelnummer: 584663
Alternativnummer: USB-584663-20,USB-584663-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Pigment protein that is intensely purple in color. Source: Recombinant protein corresponding to aa1-62 from Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595, fused to FC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~35.7kD Amino Acid Sequence: MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.7
UniProt: Q9GZ28
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.