Glucagon Receptor, Recombinant, Human, aa26-136, His-Tag

Artikelnummer: USB-584668
Artikelname: Glucagon Receptor, Recombinant, Human, aa26-136, His-Tag
Artikelnummer: USB-584668
Hersteller Artikelnummer: 584668
Alternativnummer: USB-584668-20,USB-584668-100
Hersteller: US Biological
Kategorie: Molekularbiologie
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. Source: Recombinant protein corresponding to aa26-136 from human Glucagon receptor, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.1kD Amino Acid Sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.1
UniProt: P47871
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.