Glucagon Receptor, Recombinant, Human, aa26-136, His-Tag, Myc-Tag

Artikelnummer: USB-584670
Artikelname: Glucagon Receptor, Recombinant, Human, aa26-136, His-Tag, Myc-Tag
Artikelnummer: USB-584670
Hersteller Artikelnummer: 584670
Alternativnummer: USB-584670-20,USB-584670-100
Hersteller: US Biological
Kategorie: Molekularbiologie
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. Recombinant protein corresponding to aa26-136 from human Glucagon receptor, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~18.1kD Amino Acid Sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2ug/mL can bind Anti-GCGR. The EC50 is 3.747-6.666ng/mL. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.1
UniProt: P47871
Reinheit: 95% (SDS-PAGE). Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder in 20mM Tris-HCl, pH 8.0, 6% trehalose, 0.5M sodium chloride, 50% glycerol