Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag

Produktübersicht

• Artikelname: Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag
• Artikelnummer: USB-584673
• Hersteller Artikelnummer: 584673
• Alternativnummer: USB-584673-20,USB-584673-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Partial recombinant protein corresponding to aa22-135 from rat Glucagon-like peptide 1 receptor, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~15.6kD Amino Acid Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 15.6
• UniProt: P32301
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.