Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag

Artikelnummer: USB-584675
Artikelname: Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag
Artikelnummer: USB-584675
Hersteller Artikelnummer: 584675
Alternativnummer: USB-584675-20,USB-584675-100
Hersteller: US Biological
Kategorie: Molekularbiologie
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. Source: Recombinant protein corresponding to aa22-135 from rat Glucagon-like peptide 1 receptor, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.1kD Amino Acid Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.1
UniProt: P32301
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.