Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-GST-Tag

Artikelnummer: USB-584676
Artikelname: Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-GST-Tag
Artikelnummer: USB-584676
Hersteller Artikelnummer: 584676
Alternativnummer: USB-584676-20,USB-584676-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor for glucocorticoids (GC). Source: Recombinant protein corresponding to aa521-777 from human Glucocorticoid receptor, fused to 10X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~59.8kD Amino Acid Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 59.8
UniProt: P04150
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.