Glutathione Peroxidase-like Peroxiredoxin 2, Recombinant, Saccharomyces cerevisiae, aa1-162, His-Tag, Myc-Tag

Artikelnummer: USB-584692
Artikelname: Glutathione Peroxidase-like Peroxiredoxin 2, Recombinant, Saccharomyces cerevisiae, aa1-162, His-Tag, Myc-Tag
Artikelnummer: USB-584692
Hersteller Artikelnummer: 584692
Alternativnummer: USB-584692-20,USB-584692-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. Plays an important role in the oxidative stress-induced response in the presence of Ca(2+). Has peroxidase activity using preferentially thioredoxin as a reducing power. The redox state of the mitochondrial GPX2 is regulated by TRX1 and TRX2 (cytoplasmic thioredoxin), and by TRX3 (mitochondrial matrix thioredoxin). Involved in sporulation. Source: Recombinant protein corresponding to aa1-162 from Saccharomyces cerevisiae Glutathione peroxidase-like peroxiredoxin 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.4kD Amino Acid Sequence: MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.4
UniProt: P38143
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.