Glycoprotein Hormones Alpha Chain, Recombinant, Canine, aa25-120, His-Tag, Myc-Tag

Artikelnummer: USB-584716
Artikelname: Glycoprotein Hormones Alpha Chain, Recombinant, Canine, aa25-120, His-Tag, Myc-Tag
Artikelnummer: USB-584716
Hersteller Artikelnummer: 584716
Alternativnummer: USB-584716-20,USB-584716-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Recombinant protein corresponding to aa25-120 from canine Glycoprotein hormones alpha chain, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~18.1kD Amino Acid Sequence: FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.1
UniProt: Q9XSW8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.