Golgi SNAP Receptor Complex Member 2, Recombinant, Human, aa1-190, His-SUMO-Tag

Artikelnummer: USB-584733
Artikelname: Golgi SNAP Receptor Complex Member 2, Recombinant, Human, aa1-190, His-SUMO-Tag
Artikelnummer: USB-584733
Hersteller Artikelnummer: 584733
Alternativnummer: USB-584733-20,USB-584733-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network. Source: Recombinant protein corresponding to aa1-190 from human Golgi SNAP receptor complex member 2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.3kD Amino Acid Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.3
UniProt: O14653
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.