Griffithsin, Recombinant, Griffithsia sp., aa1-121, His-Tag

Artikelnummer: USB-584749
Artikelname: Griffithsin, Recombinant, Griffithsia sp., aa1-121, His-Tag
Artikelnummer: USB-584749
Hersteller Artikelnummer: 584749
Alternativnummer: USB-584749-20,USB-584749-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mixed specificity lectin with anti-HIV activity. Binds to HIV envelope glycoproteins, including exterior membrane glycoprotein gp120, and inhibits viral entry into cells. Binding to gp120 is dependent on gp120 being glycosylated, and is inhibited by mannose, glucose and N-acetylglucosamine. Source: Recombinant protein corresponding to aa1-121 from Griffithsia sp. Griffithsin, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.7kD Amino Acid Sequence: SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.7
UniProt: P84801
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.