GTP-binding Nuclear Protein GSP1/CNR1, Recombinant, Saccharomyces cerevisiae, aa2-219, His-Tag

Artikelnummer: USB-584763
Artikelname: GTP-binding Nuclear Protein GSP1/CNR1, Recombinant, Saccharomyces cerevisiae, aa2-219, His-Tag
Artikelnummer: USB-584763
Hersteller Artikelnummer: 584763
Alternativnummer: USB-584763-20, USB-584763-100
Hersteller: US Biological
Kategorie: Molekularbiologie
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1. Source: Recombinant protein corresponding to aa2-219 from Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.7kD Amino Acid Sequence: SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.7
UniProt: P32835
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.