GTPase NRas, Recombinant, Human, aa1-186, His-GST-Tag, Myc-Tag

Artikelnummer: USB-584765
Artikelname: GTPase NRas, Recombinant, Human, aa1-186, His-GST-Tag, Myc-Tag
Artikelnummer: USB-584765
Hersteller Artikelnummer: 584765
Alternativnummer: USB-584765-20,USB-584765-100,USB-584765-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Source: Recombinant protein corresponding to aa1-186 from human GTPase NRas, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~56.1kD Amino Acid Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 56.1
UniProt: P01111
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.