Guanylate Cyclase Activator 2B, Recombinant, Human, aa27-112, His-Tag

Artikelnummer: USB-584772
Artikelname: Guanylate Cyclase Activator 2B, Recombinant, Human, aa27-112, His-Tag
Artikelnummer: USB-584772
Hersteller Artikelnummer: 584772
Alternativnummer: USB-584772-20,USB-584772-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. Recombinant protein corresponding to aa27-112 from human Guanylate cyclase activator 2B, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~13.5kD Amino Acid Sequence: VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.5
UniProt: Q16661
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.