H19B Shiga-like Toxin 1 Subunit B, Recombinant, Enterobacteria phage, aa21-89, His-Tag

Artikelnummer: USB-584775
Artikelname: H19B Shiga-like Toxin 1 Subunit B, Recombinant, Enterobacteria phage, aa21-89, His-Tag
Artikelnummer: USB-584775
Hersteller Artikelnummer: 584775
Alternativnummer: USB-584775-20,USB-584775-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. Source: Recombinant protein corresponding to aa21-89 from Enterobacteria phage H19B Shiga-like toxin 1 subunit B, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~11.7kD Amino Acid Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.7
UniProt: P69179
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.