Hemoglobin Subunit Gamma-1, Recombinant, Human, aa2-147, His-Tag, Myc-Tag

Artikelnummer: USB-584818
Artikelname: Hemoglobin Subunit Gamma-1, Recombinant, Human, aa2-147, His-Tag, Myc-Tag
Artikelnummer: USB-584818
Hersteller Artikelnummer: 584818
Alternativnummer: USB-584818-20,USB-584818-100,USB-584818-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. Recombinant protein corresponding to aa2-147 from human Hemoglobin subunit gamma-1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.0kD Amino Acid Sequence: GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23
UniProt: P69891
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.