Hexon Protein, Recombinant, Human adenovirus B serotype 3, aa625-853, His-Tag

Artikelnummer: USB-584842
Artikelname: Hexon Protein, Recombinant, Human adenovirus B serotype 3, aa625-853, His-Tag
Artikelnummer: USB-584842
Hersteller Artikelnummer: 584842
Alternativnummer: USB-584842-20, USB-584842-100, USB-584842-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus. Partial recombinant protein corresponding to aa625-853 from human adenovirus B serotype 3 Hexon protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Swiss/UniProt Accession: P36849. Molecular Weight: ~33.7kD Amino Acid Sequence: MLRNDTNDQSFNDYLSAANMLYPIPANATNIPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVAIMFDSSVSWPGNDRLLSPNEFEIKRTVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPEGYKDRMYSFFRNFQPMSRQVVDEVNYTDYKAVTLPYQHNNSGFVGYLAPTMRQGEPYPANYPYPLIGTTAVKSVTQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.7
UniProt: P36849
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol