High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma, Recombinant, Human, aa45-86, His-B2M-Tag

Artikelnummer: USB-584844
Artikelname: High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma, Recombinant, Human, aa45-86, His-B2M-Tag
Artikelnummer: USB-584844
Hersteller Artikelnummer: 584844
Alternativnummer: USB-584844-20,USB-584844-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin. Source: Recombinant protein corresponding to aa45-86 from human High affinity immunoglobulin epsilon receptor subunit gamma, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.9kD Amino Acid Sequence: RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.9
UniProt: P30273
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.