HLA Class II Histocompatibility Antigen, DRB1-12 Beta Chain, Recombinant, Human, aa31-266, His-Tag

Artikelnummer: USB-584862
Artikelname: HLA Class II Histocompatibility Antigen, DRB1-12 Beta Chain, Recombinant, Human, aa31-266, His-Tag
Artikelnummer: USB-584862
Hersteller Artikelnummer: 584862
Alternativnummer: USB-584862-20,USB-584862-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa31-266 from human HLA class II histocompatibility antigen, DRB1-12 beta chain, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.9kD Amino Acid Sequence: DTRPRFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.9
UniProt: Q95IE3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol