HLA Class II Histocompatibility Antigen, DRB1-3 Chain, Recombinant, Human, aa31-266, His-Tag

Artikelnummer: USB-584876
Artikelname: HLA Class II Histocompatibility Antigen, DRB1-3 Chain, Recombinant, Human, aa31-266, His-Tag
Artikelnummer: USB-584876
Hersteller Artikelnummer: 584876
Alternativnummer: USB-584876-20,USB-584876-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa31-266 from human HLA class II histocompatibility antigen, DRB1-3 chain, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.1kD Amino Acid Sequence: DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.1
UniProt: P01912
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.