Holo-[acyl-carrier-protein] Synthase, Recombinant, Streptococcus pyogenes Serotype M28, aa1-118, His-Tag, Myc-Tag

Artikelnummer: USB-584879
Artikelname: Holo-[acyl-carrier-protein] Synthase, Recombinant, Streptococcus pyogenes Serotype M28, aa1-118, His-Tag, Myc-Tag
Artikelnummer: USB-584879
Hersteller Artikelnummer: 584879
Alternativnummer: USB-584879-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Transfers the 4-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Source: Recombinant protein corresponding to aa1-118 from Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~17.1kD Amino Acid Sequence: MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.1
UniProt: Q48RM7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.