Homeobox Protein Meis1, Recombinant, Human, aa180-320, His-Tag

Produktübersicht

• Artikelname: Homeobox Protein Meis1, Recombinant, Human, aa180-320, His-Tag
• Artikelnummer: USB-584882
• Hersteller Artikelnummer: 584882
• Alternativnummer: USB-584882-20, USB-584882-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias. Source: Recombinant protein corresponding to aa180-320 from human Homeobox protein Meis1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.4kD Amino Acid Sequence: KMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 17.4
• UniProt: O00470
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.