Homeobox Protein Nkx-3.2, Recombinant, Mouse, aa1-333

Artikelnummer: USB-584886
Artikelname: Homeobox Protein Nkx-3.2, Recombinant, Mouse, aa1-333
Artikelnummer: USB-584886
Hersteller Artikelnummer: 584886
Alternativnummer: USB-584886-20,USB-584886-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development, required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear, required for tympanic ring and gonium development and in the regulation of the width of the malleus. Full length recombinant protein corresponding to aa1-333 from mouse Homeobox protein Nkx-3.2, expressed in E.coli. Molecular Weight: ~35.2kD Amino Acid Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.2
UniProt: P97503
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.