Homeobox Protein Nkx-3.2, Recombinant, Mouse, aa1-333, His-SUMO-Tag

Artikelnummer: USB-584887
Artikelname: Homeobox Protein Nkx-3.2, Recombinant, Mouse, aa1-333, His-SUMO-Tag
Artikelnummer: USB-584887
Hersteller Artikelnummer: 584887
Alternativnummer: USB-584887-20,USB-584887-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development, required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear, required for tympanic ring and gonium development and in the regulation of the width of the malleus. Source: Recombinant protein corresponding to aa1-333 from mouse Homeobox protein Nkx-3.2, fused to 10X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~53.7kD Amino Acid Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 53.7
UniProt: P97503
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.