Host-nuclease Inhibitor Protein Gam, Recombinant, Enterobacteria phage lambda, aa1-138, His-Tag, Myc-Tag

Artikelnummer: USB-584889
Artikelname: Host-nuclease Inhibitor Protein Gam, Recombinant, Enterobacteria phage lambda, aa1-138, His-Tag, Myc-Tag
Artikelnummer: USB-584889
Hersteller Artikelnummer: 584889
Alternativnummer: USB-584889-20,USB-584889-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds to host RecBCD nuclease and inhibits it thereby protecting the viral DNA against recBCD mediated degradation. Source: Recombinant protein corresponding to aa1-138 from Enterobacteria phage lambda Host-nuclease inhibitor protein gam, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.8kD Amino Acid Sequence: MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYYIQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.8
UniProt: P03702
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.