Hyaluronan and Proteoglycan Link Protein 1, Recombinant, Human, aa16-354, His-Tag

Produktübersicht

• Artikelname: Hyaluronan and Proteoglycan Link Protein 1, Recombinant, Human, aa16-354, His-Tag
• Artikelnummer: USB-584894
• Hersteller Artikelnummer: 584894
• Alternativnummer: USB-584894-20,USB-584894-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix. Source: Recombinant protein corresponding to aa16-354 from human Hyaluronan and proteoglycan link protein 1, fused to 10X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~41.0kD Amino Acid Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41
• UniProt: P10915
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.