Hydrophobin, Recombinant, Neosartorya fumigata, aa19-159, His-B2M-Tag

Artikelnummer: USB-584910
Artikelname: Hydrophobin, Recombinant, Neosartorya fumigata, aa19-159, His-B2M-Tag
Artikelnummer: USB-584910
Hersteller Artikelnummer: 584910
Alternativnummer: USB-584910-20,USB-584910-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia. Source: Recombinant protein corresponding to aa19-159 from Neosartorya fumigata Hydrophobin, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.3kD Amino Acid Sequence: LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.3
UniProt: P41746
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.