Hyphal Wall Protein 1, Recombinant, Candida albicans, aa27-203, His-Tag

Produktübersicht

• Artikelname: Hyphal Wall Protein 1, Recombinant, Candida albicans, aa27-203, His-Tag
• Artikelnummer: USB-584911
• Hersteller Artikelnummer: 584911
• Alternativnummer: USB-584911-20,USB-584911-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Major hyphal cell wall protein which plays a role of adhesin and is required for mating, normal hyphal development, cell-to-cell adhesive functions necessary for biofilm integrity, attachment to host, and virulence. Promotes interactions with host and bacterial molecules, thus leading to effective colonization within polymicrobial communities. Plays a crucial role in gastrointestinal colonization, in mucosal symptomatic and asymptomatic infections, in vaginitis, as well as in lethal oroesophageal candidiasis, caused by the combined action of fungal virulence factors and host inflammatory responses when protective immunity is absent. Source: Recombinant protein corresponding to aa27-203 from Candida albicans Hyphal wall protein 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.2kD Amino Acid Sequence: GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 24.2
• UniProt: P46593
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.