Ice nucleation proteins enable bacteria to nucleate crystallization in supercooled water. Partial recombinant protein corresponding to aa1412-1567 from Xanthomonas campestris pv. translucens Ice nucleation protein, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot Accession: P18127 Molecular Weight: ~22.3kD Amino Acid Sequence: AGDRSKLIAGADSTQTAGDRSKLLAGRNSYLTAGDRSKLTAGDDSTLMAGDRSKLTAGKNSVLTAGANSRLIGSLGSTLSGGENSTLIFRCWDGERYTNLVVRTGEQGVESDIPYQVDDEGNLVGKADDDLVLDYDPGMILDGQCSPGTGEELRDV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
