ICP47 Protein, Recombinant, Herpes Simplex Virus Type 2, aa1-78, His-KSI-Tag

Artikelnummer: USB-584921
Artikelname: ICP47 Protein, Recombinant, Herpes Simplex Virus Type 2, aa1-78, His-KSI-Tag
Artikelnummer: USB-584921
Hersteller Artikelnummer: 584921
Alternativnummer: USB-584921-20,USB-584921-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing (TAP), thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes. Source: Recombinant protein corresponding to aa1-78 from Herpes simplex virus type 2 ICP47 protein, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.9kD Amino Acid Sequence: MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.9
UniProt: P60504
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.