Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, MBP-Tag, His-Tag

Artikelnummer: USB-584933
Artikelname: Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, MBP-Tag, His-Tag
Artikelnummer: USB-584933
Hersteller Artikelnummer: 584933
Alternativnummer: USB-584933-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa24-228 from Mycobacterium tuberculosis Immunogenic protein MPT64, fused to MBP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~66.4kD Amino Acid Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 66.4
UniProt: P9WIN9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol